RCE1 Rabbit Polyclonal Antibody

CAT#: TA335719

Rabbit Polyclonal Anti-RCE1 Antibody

Product Images

WB Suggested Anti-RCE1 Antibody Titration: 1.25 ug/ml; Positive Control: HepG2 cell lysate;RCE1 is supported by BioGPS gene expression data to be expressed in HepG2

• 

  Human Muscle

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-RCE1 Antibody: synthetic peptide directed towards the N terminal of human RCE1. Synthetic peptide located within the following region: WARCLTDMRWLRNQVIAPLTEELVFRACMLPMLAPCMGLGPAVFTCPLFF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: Ras converting CAAX endopeptidase 1
• Database Link:
  NP_005124
  Entrez Gene 9986 Human
  UniProt ID Q9Y256
• Background: RCE1 is an integral membrane protein which is classified as a member of the metalloproteinase family. This enzyme is thought to function in the maintenance and processing of CAAX-type prenylated proteins.This gene encodes an integral membrane protein which is classified as a member of the metalloproteinase family. This enzyme is thought to function in the maintenance and processing of CAAX-type prenylated proteins.
• Synonyms: FACE2; RCE1A; RCE1B
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Goat: 93%; Zebrafish: 93%

Reference Data

• Protein Families: Protease, Transmembrane