PDE1A Rabbit Polyclonal Antibody

CAT#: TA335729

Rabbit Polyclonal Anti-PDE1A Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "PDE1A"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-PDE1A Antibody: synthetic peptide directed towards the C terminal of human PDE1A. Synthetic peptide located within the following region: AVDLKSFKNNLVDIIQQNKERWKELAAQGESDLHKNSEDLVNAEEKHDET
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 60 kDa
Gene Name phosphodiesterase 1A
Background PDE1A belongs to the cyclic nucleotide phosphodiesterase family. It has a higher affinity for cGMP than for cAMP. The exact function of PDE1A remains unknown.
Synonyms CAM-PDE-1A; HCAM-1; HCAM1; HSPDE1A
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rat: 93%; Mouse: 86%
Reference Data
Protein Families Druggable Genome
Protein Pathways Calcium signaling pathway, Progesterone-mediated oocyte maturation, Purine metabolism, Taste transduction

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.