SIAH1 Rabbit Polyclonal Antibody

CAT#: TA335795

Rabbit Polyclonal Anti-SIAH1 Antibody

Product Images

WB Suggested Anti-SIAH1 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human Placenta

• 

  Lanes: Lane 1: 50 ug human HEK-293T lysate; Primary Antibody Dilution: 1: 1000; Secondary Antibody: Anti-rabbit-IgG; Secondary Antibody Dilution: 1: 5000; Gene Name: SIAH1; Submitted by: Peter Brand & Dr. Oliver Kramer, Institute for Biochemistry and Biophysics, Center for Molecular Biomedicine, Friedrich-Schiller University Jena; SIAH1 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells

• 

  Liver

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SIAH1 Antibody: synthetic peptide directed towards the C terminal of human SIAH1. Synthetic peptide located within the following region: LVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 31 kDa
• Gene Name: siah E3 ubiquitin protein ligase 1
• Database Link:
  NP_003022
  Entrez Gene 6477 Human
  UniProt ID Q8IUQ4
• Background: SIAH1 is a protein that is a member of the seven in absentia homolog (SIAH) family. The protein is an E3 ligase and is involved in ubiquitination and proteasome-mediated degradation of specific proteins. The activity of this ubiquitin ligase has been implicated in the development of certain forms of Parkinson's disease, the regulation of the cellular response to hypoxia and induction of apoptosis. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterizedThis gene encodes a protein that is a member of the seven in absentia homolog (SIAH) family. The protein is an E3 ligase and is involved in ubiquitination and proteasome-mediated degradation of specific proteins. The activity of this ubiquitin ligase has been implicated in the development of certain forms of Parkinson's disease, the regulation of the cellular response to hypoxia and induction of apoptosis. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterized.
• Synonyms: SIAH1A
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: p53 signaling pathway, Ubiquitin mediated proteolysis, Wnt signaling pathway