CSNK2A2 Rabbit Polyclonal Antibody

CAT#: TA335861

Rabbit Polyclonal Anti-CSNK2A2 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "CSNK2A2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-CSNK2A2 Antibody: synthetic peptide directed towards the C terminal of human CSNK2A2. Synthetic peptide located within the following region: LLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 39 kDa
Gene Name casein kinase 2 alpha 2
Background CSNK2A2 belongs to the protein kinase superfamily, Ser/Thr protein kinase family, CK2 subfamily. It contains 1 protein kinase domain. Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. The alpha and alpha' chains contain the catalytic site. CSNK2A2 participates in Wnt signaling. It phosphorylates 'Ser-392' of p53/TP53 following UV irradiation.
Synonyms CK2A2; CK2alpha; CK2alpha'; CSNK2A1
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%; Yeast: 92%; Rat: 86%; Mouse: 86%
Reference Data
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Adherens junction, Tight junction, Wnt signaling pathway

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.