CRIP2 Rabbit Polyclonal Antibody

CAT#: TA335870

Rabbit Polyclonal Anti-CRIP2 Antibody

Product Images

WB Suggested Anti-CRIP2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: MCF7 cell lysate. CRIP2 is supported by BioGPS gene expression data to be expressed in MCF7

• 

  Rabbit Anti-CRIP2 Antibody; Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue; Observed Staining: Cytoplasmic in alveolar type I cells; Primary Antibody Concentration: 1:100; Other Working Concentrations: 1/600; Secondary Antibody: Donkey anti-Rabbit-Cy3; Secondary Antibody Concentration: 1:200; Magnification: 20X; Exposure Time: 0.5 - 2.0 sec;

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CRIP2 Antibody: synthetic peptide directed towards the middle region of human CRIP2. Synthetic peptide located within the following region: TLTPGGHAEHDGQPYCHKPCYGILFGPKGVNTGAVGSYIYDRDPEGKVQP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 22 kDa
• Gene Name: cysteine rich protein 2
• Database Link:
  NP_001303
  Entrez Gene 1397 Human
  UniProt ID P52943
• Background: The exact function of CRIP2 remains unknown.
• Synonyms: CRIP; CRP2; ESP1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 93%; Horse: 79%