CRIP2 Rabbit Polyclonal Antibody

CAT#: TA335871

Rabbit Polyclonal Anti-CRIP2 Antibody

Product Images

WB Suggested Anti-CRIP2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human Placenta

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CRIP2 Antibody: synthetic peptide directed towards the N terminal of human CRIP2. Synthetic peptide located within the following region: EKPLAEGPQVTGPIEVPAARAEERKASGPPKGPSRASSVTTFTGEPNTCP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 22 kDa
• Gene Name: cysteine rich protein 2
• Database Link:
  NP_001303
  Entrez Gene 1397 Human
  UniProt ID P52943
• Background: Human ESP1/CRP2 protein has two LIM domains, and each shares 35.1% and 77 or 79% identical residues with human cysteine-rich protein (CRP) and rat CRIP, respectively. Northern blot analysis of ESP1/CRP2 in various human tissues showed distinct tissue distributions compared with CRP and CRIP, suggesting that each might serve related but specific roles in tissue organization or function. Using a panel of human-rodent somatic cell hybrids, the ESP1/CRP2 locus was assigned to chromosome 14. Fluorescence in situ hybridization, using cDNA and a genome DNA fragment of the ESP1/CRP2 as probes, confirms this assignment and relegates regional localization to band 14q32.3.
• Synonyms: CRIP; CRP2; ESP1
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Guinea pig: 100%; Dog: 93%; Rat: 93%; Mouse: 93%; Bovine: 93%