SPOCK3 Rabbit Polyclonal Antibody

CAT#: TA335971

Rabbit Polyclonal Anti-SPOCK3 Antibody

Product Images

WB Suggested Anti-SPOCK3 Antibody Titration: 0.2-1 ug/ml; Positive Control: OVCAR-3 cell lysate;SPOCK3 is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SPOCK3 Antibody: synthetic peptide directed towards the middle region of human SPOCK3. Synthetic peptide located within the following region: VDRYGNEVMGSRINGVADCAIDFEISGDFASGDFHEWTDDEDDEDDIMND
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3
• Database Link:
  NP_001035249
  Entrez Gene 50859 Human
  UniProt ID Q9BQ16
• Background: Proteoglycans, which consist of a core protein and covalently linked glycosaminoglycans, are components of the extracellular matrix. SPOCK3 is a member of a novel Ca(2+)-binding proteoglycan family .
• Synonyms: HSAJ1454; TES-3; TICN3
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 93%

Reference Data

• Protein Families: Secreted Protein, Transmembrane