l Afadin (AFDN) Rabbit Polyclonal Antibody
Other products for "AFDN"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-MLLT4 Antibody: synthetic peptide directed towards the N terminal of human MLLT4. Synthetic peptide located within the following region: GVIQNFKRTLSKKEKKEKKKREKEALRQASDKDDRPFQGEDVENSRLAAE |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 74 kDa |
Gene Name | myeloid/lymphoid or mixed-lineage leukemia; translocated to, 4 |
Database Link | |
Background | AF6 is a Ras target that regulates cell-cell adhesions downstream of Ras activation. It is fused with MLL in leukemias caused by t(6;11) translocations. |
Synonyms | AF6 |
Note | Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Pig: 93%; Horse: 93%; Mouse: 93%; Yeast: 92%; Guinea pig: 92%; Zebrafish: 91%; Rabbit: 85% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Adherens junction, Leukocyte transendothelial migration, Tight junction |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.