ACBD7 Rabbit Polyclonal Antibody

CAT#: TA335984

Rabbit Polyclonal Anti-PALM Antibody

Product Images

WB Suggested Anti-PALM Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: MCF7 cell lysate

• 

  Host: Rabbit; Target Name: PALM; Sample Tissue: Human Fetal Lung; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: PALM; Sample Tissue: Human Fetal Brain; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PALM Antibody: synthetic peptide directed towards the N terminal of human PALM. Synthetic peptide located within the following region: LEDERRQLQHLKSKALRERWLLEGTPSSASEGDEDLRRQMQDDEQKTRLL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: acyl-CoA binding domain containing 7
• Database Link:
  NP_001034933
  Entrez Gene 414149 Human
  UniProt ID Q8N6N7
• Background: This gene encodes a member of the paralemmin protein family. The product of this gene is a prenylated and palmitoylated phosphoprotein that associates with the cytoplasmic face of plasma membranes and is implicated in plasma membrane dynamics in neurons and other cell types. Several alternatively spliced transcript variants have been identified, but the full-length nature of only two transcript variants has been determined.
• Synonyms: bA455B2.2
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 93%; Bovine: 93%; Pig: 86%; Mouse: 86%; Dog: 79%; Rabbit: 79%