DNAJC25 Rabbit Polyclonal Antibody

CAT#: TA336081

Rabbit Polyclonal Anti-DNAJC25 Antibody

Product Images

WB Suggested Anti-DNAJC25 Antibody Titration: 0.2-1 ug/ml; Positive Control: COLO205 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-DNAJC25 Antibody: synthetic peptide directed towards the middle region of human DNAJC25. Synthetic peptide located within the following region: RDEEENIIKNIIKSKIDIKGGYQKPQICDLLLFQIILAPFHLCSYIVWYC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: DnaJ heat shock protein family (Hsp40) member C25
• Database Link:
  NP_001015882
  Entrez Gene 548645 Human
  UniProt ID Q9H1X3
• Background: The function of this protein remains unknown.
• Synonyms: bA16L21.2.1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 92%

Reference Data

• Protein Families: Transmembrane