C1orf103 (LRIF1) Rabbit Polyclonal Antibody

CAT#: TA336159

Rabbit Polyclonal Anti-C1orf103 Antibody

Product Images

WB Suggested Anti-C1orf103 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Placenta

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-C1orf103 Antibody: synthetic peptide directed towards the N terminal of human C1orf103. Synthetic peptide located within the following region: KKIFGLTKDLRVCLTRIPDHLTSGEGFDSFSSLVKSGTYKETEFMVKEGE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 27 kDa
• Gene Name: ligand dependent nuclear receptor interacting factor 1
• Database Link:
  NP_001006946
  Entrez Gene 55791 Human
  UniProt ID Q5T3J3
• Background: The specific function of this protein remains unknown.
• Synonyms: C1orf103; RIF1
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 93%; Rat: 90%; Dog: 86%; Pig: 86%; Mouse: 79%; Rabbit: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Stem cell - Pluripotency