Host cell factor C1 regulator 1 (HCFC1R1) Rabbit Polyclonal Antibody

CAT#: TA336194

Rabbit Polyclonal Anti-HCFC1R1 Antibody

Product Images

WB Suggested Anti-HCFC1R1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Spleen

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-HCFC1R1 Antibody: synthetic peptide directed towards the middle region of human HCFC1R1. Synthetic peptide located within the following region: LRGAVPMSTKRRLEEEQEPLRKQFLSEENMATHFSQLSLHNDHPYCSPPM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 15 kDa
• Gene Name: host cell factor C1 regulator 1
• Database Link:
  NP_001002018
  Entrez Gene 54985 Human
  UniProt ID Q9NWW0
• Background: HCFC1R1 regulates HCFC1 activity by modulating its subcellular localization. Overexpression of HCFC1R1 leads to accumulation of HCFC1 in the cytoplasm. HCFC1R1-mediated export may provide the pool of cytoplasmic HCFC1 required for import of virion-derived VP16 into the nucleus.
• Synonyms: HPIP
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Goat: 93%; Mouse: 92%; Rat: 83%

Reference Data

• Protein Families: Druggable Genome