DCP1A Rabbit Polyclonal Antibody

CAT#: TA337231

Rabbit Polyclonal Anti-DCP1A Antibody

Product Images

WB Suggested Anti-DCP1A Antibody Titration: 2.5 ug/ml; ELISA Titer: 1:62500; Positive Control: Jurkat cell lysateDCP1A is supported by BioGPS gene expression data to be expressed in Jurkat

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DCP1A antibody: synthetic peptide directed towards the N terminal of human DCP1A. Synthetic peptide located within the following region: EEMPSGSQDKSAPSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 56 kDa
• Gene Name: decapping mRNA 1A
• Database Link:
  NP_060873
  Entrez Gene 55802 Human
  UniProt ID Q9NPI6
• Background: Decapping is a key step in general and regulated mRNA decay. The protein encoded by this gene is a decapping enzyme. This protein and another decapping enzyme form a decapping complex, which interacts with the nonsense-mediated decay factor hUpf1 and may be recruited to mRNAs containing premature termination codons. This protein also participates in the TGF-beta signaling pathway.
• Synonyms: HSA275986; Nbla00360; SMAD4IP1; SMIF
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 92%

Reference Data

• Protein Families: Transcription Factors
• Protein Pathways: RNA degradation