ADPGK Rabbit Polyclonal Antibody
Other products for "ADPGK"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ADPGK antibody: synthetic peptide directed towards the N terminal of human ADPGK. Synthetic peptide located within the following region: SILHSRNDLEEAFIHFMGKGAAAERFFSDKETFHDIAQVASEFPGAQHYV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 54 kDa |
Gene Name | ADP-dependent glucokinase |
Database Link | |
Background | ADPGK (EC 2.7.1.147) catalyzes the ADP-dependent phosphorylation of glucose to glucose-6-phosphate and may play a role in glycolysis, possibly during ischemic conditions. ADPGK (EC 2.7.1.147) catalyzes the ADP-dependent phosphorylation of glucose to glucose-6-phosphate and may play a role in glycolysis, possibly during ischemic conditions (Ronimus and Morgan, 2004 [PubMed 14975750]). [supplied by OMIM] |
Synonyms | 2610017G09Rik; ADP-GK |
Note | Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Mouse: 93%; Pig: 92%; Rat: 92%; Guinea pig: 92%; Horse: 86%; Rabbit: 83%; Dog: 77% |
Reference Data |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.