ADPGK Rabbit Polyclonal Antibody

CAT#: TA337263

Rabbit Polyclonal Anti-ADPGK Antibody

Product Images

Host: Rabbit; Target Name: ADPGK; Sample Tissue: Human Fetal Lung; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: ADPGK; Sample Tissue: Human Fetal Liver; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: ADPGK; Sample Tissue: Human Fetal Brain; Antibody Dilution: 1.0 ug/ml

• 

  WB Suggested Anti-ADPGK Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: COLO205 cell lysateADPGK is supported by BioGPS gene expression data to be expressed in COLO205

• 

  Host: Rabbit; Target Name: ADPGK; Sample Tissue: MCF7; Antibody Dilution: 1.0 ug/ml ADPGK is supported by BioGPS gene expression data to be expressed in MCF7

• 

  Host: Rabbit; Target Name: ADPGK; Sample Tissue: Hela; Antibody Dilution: 1.0 ug/ml ADPGK is supported by BioGPS gene expression data to be expressed in HeLa

• Host: Rabbit; Target Name: ADPGK; Sample Tissue: 293T; Antibody Dilution: 1.0 ug/ml ADPGK is supported by BioGPS gene expression data to be expressed in HEK293T

Show all 7 images

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ADPGK antibody: synthetic peptide directed towards the N terminal of human ADPGK. Synthetic peptide located within the following region: SILHSRNDLEEAFIHFMGKGAAAERFFSDKETFHDIAQVASEFPGAQHYV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 54 kDa
• Gene Name: ADP-dependent glucokinase
• Database Link:
  NP_112574
  Entrez Gene 83440 Human
  UniProt ID Q9BRR6
• Background: ADPGK (EC 2.7.1.147) catalyzes the ADP-dependent phosphorylation of glucose to glucose-6-phosphate and may play a role in glycolysis, possibly during ischemic conditions. ADPGK (EC 2.7.1.147) catalyzes the ADP-dependent phosphorylation of glucose to glucose-6-phosphate and may play a role in glycolysis, possibly during ischemic conditions (Ronimus and Morgan, 2004 [PubMed 14975750]). [supplied by OMIM]
• Synonyms: 2610017G09Rik; ADP-GK
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Mouse: 93%; Pig: 92%; Rat: 92%; Guinea pig: 92%; Horse: 86%; Rabbit: 83%; Dog: 77%