PAX8 Rabbit Polyclonal Antibody

CAT#: TA337290

Rabbit Polyclonal Anti-PAX8 Antibody

Product Images

WB Suggested Anti-PAX8 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: NCI-H226 cell lysate

• 

  Thyroid

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PAX8 antibody: synthetic peptide directed towards the middle region of human PAX8. Synthetic peptide located within the following region: SSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQGERWW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: paired box 8
• Database Link:
  NP_039247
  Entrez Gene 7849 Human
  UniProt ID Q06710
• Background: PAX8 is a member of the paired box (PAX) family of transcription factors. Members of this family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. This nuclear protein is involved in thyroid follicular cell development
• Synonyms: OTTHUMP00000158659; OTTHUMP00000158660; paired box 8; paired domain gene 8
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 79%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Pathways in cancer, Thyroid cancer