GPR176 Rabbit Polyclonal Antibody

CAT#: TA337329

Rabbit Polyclonal Anti-GPR176 Antibody

Product Images

Host: Rabbit; Target Name: GPR176; Sample Tissue: PANC1 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-GPR176 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR176. Synthetic peptide located within the following region: LEPSIRSGSQLLEMFHIGQQQIFKPTEDEEESEAKYIGSADFQAKEIFST
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 56 kDa
• Gene Name: G protein-coupled receptor 176
• Database Link:
  NP_009154
  Entrez Gene 11245 Human
  UniProt ID Q14439
• Background: Members of the G protein-coupled receptor family, such as GPR176, are cell surface receptors involved in responses to hormones, growth factors, and neurotransmitters.
• Synonyms: HB-954
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Pig: 92%; Mouse: 92%; Yeast: 90%; Rabbit: 85%; Guinea pig: 85%

Reference Data

• Protein Families: Druggable Genome, GPCR, Transmembrane