HENMT1 Rabbit Polyclonal Antibody

CAT#: TA337342

Rabbit Polyclonal Anti-HENMT1 Antibody

Product Images

Host: Rabbit; Target Name: HENMT1; Sample Tissue: Fetal Liver lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-HENMT1 antibody is: synthetic peptide directed towards the C-terminal region of Human HENMT1. Synthetic peptide located within the following region: QVESLRVSHLPRRKEQAGERGDKPKDIGGSKAPVPCFGPVFTEVEKAKIE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: HEN1 methyltransferase homolog 1
• Database Link:
  NP_653185
  Entrez Gene 113802 Human
  UniProt ID Q5T8I9
• Background: HENMT1 is a methyltransferase that adds a 2'-O-methyl group at the 3'-end of piRNAs, a class of 24 to 30 nucleotide RNAs that are generated by a Dicer-independent mechanism and are primarily derived from transposons and other repeated sequence elements. This probably protects the 3'-end of piRNAs from uridylation activity and subsequent degradation. Stabilization of piRNAs is essential for gametogenesis.
• Synonyms: C1orf59; HEN1
• Note: Immunogen Sequence Homology: Human: 100%