ILDR2 Rabbit Polyclonal Antibody

CAT#: TA337355

Rabbit Polyclonal Anti-ILDR2 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "ILDR2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-ILDR2 antibody is: synthetic peptide directed towards the C-terminal region of Human ILDR2. Synthetic peptide located within the following region: AHLPRLVSRTPGTAPKYDHSYLGSARERQARPEGASRGGSLETPSKRSAQ
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 56 kDa
Gene Name immunoglobulin like domain containing receptor 2
Background The function of this protein remains unknown.
Synonyms C1orf32; dJ782G3.1
Note Immunogen Sequence Homology: Dog: 100%; Human: 100%
Reference Data
Protein Families Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.