Matrilin 3 (MATN3) Rabbit Polyclonal Antibody

CAT#: TA337662

Rabbit Polyclonal Anti-MATN3 Antibody

Product Images

WB Suggested Anti-MATN3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: 293T cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MATN3 antibody: synthetic peptide directed towards the middle region of human MATN3. Synthetic peptide located within the following region: IELYAVGVDRADMASLKMMASEPLEEHVFYVETYGVIEKLSSRFQETFCA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 50 kDa
• Gene Name: matrilin 3
• Database Link:
  NP_002372
  Entrez Gene 4148 Human
  UniProt ID O15232
• Background: This gene encodes a member of von Willebrand factor A domain containing protein family. This family of proteins is thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues. This protein contains two von Willebrand factor A domains; it is present in the cartilage extracellular matrix and has a role in the development and homeostasis of cartilage and bone. Mutations in this gene result in multiple epiphyseal dysplasia. [provided by RefSeq, Jul 2008]
• Synonyms: DIPOA; EDM5; HOA; OADIP; OS2
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Zebrafish: 93%; Rabbit: 86%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein