TBP2 (TBPL2) Rabbit Polyclonal Antibody

CAT#: TA337706

Rabbit Polyclonal Anti-TBPL2 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "TBPL2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TBPL2 antibody is: synthetic peptide directed towards the N-terminal region of Human TBPL2. Synthetic peptide located within the following region: SGDFSSVDLSFLPDEVTQENKDQPVISKHETEENSESQSPQSRLPSPSEQ
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 33 kDa
Gene Name TATA-box binding protein like 2
Background TBPL2 is a transcription factor required in complex with TAF3 for the differentiation of myoblasts into myocytes. The complex replaces TFIID at specific promoters at an early stage in the differentiation process.
Synonyms TBP2; TRF3
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Pathways Basal transcription factors, Huntington's disease

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.