TAS1R2 Rabbit Polyclonal Antibody

CAT#: TA337885

Rabbit Polyclonal Anti-TAS1R2 Antibody

Product Images

WB Suggested Anti-TAS1R2 Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TAS1R2 antibody is: synthetic peptide directed towards the C-terminal region of Human TAS1R2. Synthetic peptide located within the following region: ISWHTINNTIPMSMCSKRCQSGQKKKPVGIHVCCFECIDCLPGTFLNHTE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 93 kDa
• Gene Name: taste 1 receptor member 2
• Database Link:
  NP_689418
  Entrez Gene 80834 Human
  UniProt ID Q8TE23
• Background: TAS1R2 is a putative taste receptor. TAS1R2/TAS1R3 recognizes diverse natural and synthetic sweeteners.
• Synonyms: GPR71; T1R2; TR2
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 86%; Bovine: 79%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Taste transduction