MST1 Rabbit Polyclonal Antibody

CAT#: TA338017

Rabbit Polyclonal Anti-MST1 Antibody

Product Images

Host: Rabbit; Target Name: MST1; Sample Tissue: Thymus Tumor lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MST1 antibody is: synthetic peptide directed towards the N-terminal region of Human MST1. Synthetic peptide located within the following region: TQCLGVPGQRSPLNDFQVLRGTELQHLLHAVVPGPWQEDVADAEECAGRC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 78 kDa
• Gene Name: macrophage stimulating 1
• Database Link:
  NP_066278
  Entrez Gene 4485 Human
  UniProt ID P26927
• Background: The protein encoded by this gene contains four kringle domains and a serine protease domain, similar to that found in hepatic growth factor. Despite the presence of the serine protease domain, the encoded protein may not have any proteolytic activity. The receptor for this protein is RON tyrosine kinase, which upon activation stimulates ciliary motility of ciliated epithelial lung cells. This protein is secreted and cleaved to form an alpha chain and a beta chain bridged by disulfide bonds. [provided by RefSeq, Jan 2010]
• Synonyms: D3F15S2; DNF15S2; HGFL; MSP; NF15S2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Horse: 93%; Bovine: 93%; Rabbit: 86%

Reference Data

• Protein Families: Druggable Genome