AHA1 (AHSA1) Rabbit Polyclonal Antibody

CAT#: TA338106

Rabbit Polyclonal Anti-AHSA1 Antibody

Product Images

WB Suggested Anti-AHSA1 Antibody; Titration: 1.0 ug/ml; Positive Control: Jurkat Whole Cell AHSA1 is supported by BioGPS gene expression data to be expressed in Jurkat

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-AHSA1 antibody is: synthetic peptide directed towards the C-terminal region of Human AHSA1. Synthetic peptide located within the following region: NGESVDPVGQPALKTEERKAKPAPSKTQARPVGVKIPTCKITLKETFLTS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: activator of Hsp90 ATPase activity 1
• Database Link:
  NP_036243
  Entrez Gene 10598 Human
  UniProt ID O95433
• Background: AHSA1 is a cochaperone that stimulates HSP90 ATPase activity. AHSA1 may affect a step in the endoplasmic reticulum to Golgi trafficking.
• Synonyms: AHA1; C14orf3; p38
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Bovine: 93%; Guinea pig: 93%; Horse: 87%; Rat: 86%; Rabbit: 79%