SCTR Rabbit Polyclonal Antibody

CAT#: TA338246

Rabbit Polyclonal Anti-SCTR Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "SCTR"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SCTR antibody is: synthetic peptide directed towards the N-terminal region of Human SCTR. Synthetic peptide located within the following region: NLACGVNVNDSSNEKRHSYLLKLKVMYTVGYSSSLVMLLVALGILCAFRR
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 48 kDa
Gene Name secretin receptor
Background The protein encoded by this gene is a G protein-coupled receptor and belongs to the glucagon-VIP-secretin receptor family. It binds secretin which is the most potent regulator of pancreatic bicarbonate, electrolyte and volume secretion. Secretin and its receptor are suggested to be involved in pancreatic cancer and autism.
Synonyms SR
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Horse: 93%; Pig: 86%; Bovine: 86%; Guinea pig: 86%
Reference Data
Protein Families Druggable Genome, Transmembrane
Protein Pathways Neuroactive ligand-receptor interaction

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.