Orexin Receptor 1 (HCRTR1) Rabbit Polyclonal Antibody

CAT#: TA338269

Rabbit Polyclonal Anti-HCRTR1 Antibody

Product Images

WB Suggested Anti-HCRTR1 Antibody; Titration: 0.25 ug/ml; Positive Control: Fetal Brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HCRTR1 antibody is: synthetic peptide directed towards the N-terminal region of Human HCRTR1. Synthetic peptide located within the following region: ATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: hypocretin receptor 1
• Database Link:
  NP_001516
  Entrez Gene 3061 Human
  UniProt ID O43613
• Background: The protein encoded by this gene is a G-protein coupled receptor involved in the regulation of feeding behavior. The encoded protein selectively binds the hypothalamic neuropeptide orexin A. A related gene (HCRTR2) encodes a G-protein coupled receptor that binds orexin A and orexin B.
• Synonyms: OX1R
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Dog: 91%; Bovine: 85%; Pig: 83%; Guinea pig: 83%; Rabbit: 79%

Reference Data

• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, GPCR, Transmembrane
• Protein Pathways: Neuroactive ligand-receptor interaction