GPR35 Rabbit Polyclonal Antibody

CAT#: TA338287

Rabbit Polyclonal Anti-GPR35 Antibody

Product Images

WB Suggested Anti-GPR35 Antibody; Titration: 1.0 ug/ml; Positive Control: HT1080 Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GPR35 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR35. Synthetic peptide located within the following region: HNFNSMAFPLLGFYLPLAVVVFCSLKVVTALAQRPPTDVGQAEATRKAAR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: G protein-coupled receptor 35
• Database Link:
  NP_001182310
  Entrez Gene 2859 Human
  UniProt ID Q9HC97
• Background: GPR35 acts as a receptor for kynurenic acid, an intermediate in the tryptophan metabolic pathway. The activity of this receptor is mediated by G-proteins that elicit calcium mobilization and inositol phosphate production through G(qi/o) proteins.
• Synonyms: KPG_007
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 79%; Mouse: 79%

Reference Data

• Protein Families: Druggable Genome, GPCR, Transmembrane
• Protein Pathways: Neuroactive ligand-receptor interaction