ACCN1 (ASIC2) Rabbit Polyclonal Antibody

CAT#: TA338514

Rabbit Polyclonal Anti-ACCN1 Antibody

Product Images

WB Suggested Anti-ACCN1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ACCN1 antibody: synthetic peptide directed towards the C terminal of human ACCN1. Synthetic peptide located within the following region: GDIGGQMGLFIGASILTILELFDYIYELIKEKLLDLLGKEEDEGSHDENV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 63 kDa
• Gene Name: acid sensing ion channel subunit 2
• Database Link:
  NP_899233
  Entrez Gene 40 Human
  UniProt ID Q16515
• Background: This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. Three alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
• Synonyms: ACCN; ACCN1; ASIC2a; BNaC1; BNC1; hBNaC1; MDEG
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Mouse: 93%; Bovine: 93%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Other
• Protein Pathways: Taste transduction