GABRR1 Rabbit Polyclonal Antibody

CAT#: TA338521

Rabbit Polyclonal Anti-GABRR1 Antibody

Product Images

WB Suggested Anti-GABRR1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Hela cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GABRR1 antibody: synthetic peptide directed towards the N terminal of human GABRR1. Synthetic peptide located within the following region: EMSKKGRPQRQRREVHEDAHKQVSPILRRSPDITKSPLTKSEQLLRIDDH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 55 kDa
• Gene Name: gamma-aminobutyric acid type A receptor rho1 subunit
• Database Link:
  NP_002033
  Entrez Gene 2569 Human
  UniProt ID P24046
• Background: GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA receptors, which are ligand-gated chloride channels. GABRR1 is a member of the rho subunit family. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2012]
• Synonyms: MGC163216
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 92%; Pig: 92%; Rat: 92%; Horse: 92%; Guinea pig: 92%; Mouse: 86%; Rabbit: 86%; Bovine: 83%; Zebrafish: 83%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Cys-loop Receptors, Transmembrane
• Protein Pathways: Neuroactive ligand-receptor interaction