GABRR2 Rabbit Polyclonal Antibody

CAT#: TA338522

Rabbit Polyclonal Anti-GABRR2 Antibody

Product Images

WB Suggested Anti-GABRR2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Hela cell lysate

• 

  2Hum. Fetal Brain; Host: Rabbit; Target Name: NOP56; Sample Tissue: Human Fetal Brain; Antibody Dilution: 1.0 ug/ml

• 

  3Hum. Fetal Liver; Host: Rabbit; Target Name: GABRR2; Sample Tissue: Human Fetal Liver; Antibody Dilution: 1.0 ug/ml

• 

  4Human 293T; Host: Rabbit; Target Name: HIRIP3; Sample Tissue: 293T; Antibody Dilution: 1.0 ug/ml GABRR2 is supported by BioGPS gene expression data to be expressed in HEK293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GABRR2 antibody: synthetic peptide directed towards the middle region of human GABRR2. Synthetic peptide located within the following region: SNKSMTFDGRLVKKIWVPDVFFVHSKRSFTHDTTTDNIMLRVFPDGHVLY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 54 kDa
• Gene Name: gamma-aminobutyric acid type A receptor rho2 subunit
• Database Link:
  NP_002034
  Entrez Gene 2570 Human
  UniProt ID P28476
• Background: GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA receptors, which are ligand-gated chloride channels. The protein encoded by this gene is a member of the rho subunit family and is a component of the GABA receptor complex. [provided by RefSeq, Jul 2008]
• Synonyms: GABA-C receptor; gamma-aminobutyric acid (GABA) receptor; OTTHUMP00000040625; rho-2 subunit; rho 2
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Pig: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Zebrafish: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Cys-loop Receptors, Transmembrane
• Protein Pathways: Neuroactive ligand-receptor interaction