KCND1 Rabbit Polyclonal Antibody

CAT#: TA338547

Rabbit Polyclonal Anti-Kcnd1 Antibody

Product Images

WB Suggested Anti-Kcnd1 Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Spleen

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Kcnd1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MAAGVATWLPFARAAAVGWLPLAQQPLPPAPEVKASRGDEVLVVNVSGRR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 72 kDa
• Gene Name: potassium voltage-gated channel subfamily D member 1
• Database Link:
  NP_004970
  Entrez Gene 16506 Mouse
  UniProt ID Q9NSA2
• Background: Kcnd1 is a pore-forming (alpha) subunit of voltage-gated rapidly inactivating A-type potassium channels. It may contribute to I(To) current in the heart and I(Sa) current in neurons. Channel properties are modulated by subunit assembly.
• Synonyms: KV4.1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Potassium, Transmembrane