STRA6 Rabbit Polyclonal Antibody
Other products for "STRA6"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-STRA6 antibody: synthetic peptide directed towards the N terminal of human STRA6. Synthetic peptide located within the following region: MSSQPAGNQTSPGATEDYSYGSWYIDEPQGGEELQPEGEVPSCHTSIPPG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 73 kDa |
Gene Name | stimulated by retinoic acid 6 |
Database Link | |
Background | STRA6 may act as a high-affinity cell-surface receptor for the complex retinol-retinol binding protein (RBP/RBP4). STRA6 acts by removing retinol from RBP/RBP4 and transports it across the plasma membrane, where it can be metabolized. This mechanism does not depend on endocytosis. STRA6 binds to RBP/RBP4 with high affinity. STRA6 increases cellular retinol uptake from the retinol-RBP complex. |
Synonyms | MCOPCB8; MCOPS9; PP14296 |
Note | Immunogen Sequence Homology: Human: 100% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.