STRA6 Rabbit Polyclonal Antibody

CAT#: TA338601

Rabbit Polyclonal Anti-STRA6 Antibody

Product Images

WB Suggested Anti-STRA6 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-STRA6 antibody: synthetic peptide directed towards the N terminal of human STRA6. Synthetic peptide located within the following region: MSSQPAGNQTSPGATEDYSYGSWYIDEPQGGEELQPEGEVPSCHTSIPPG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 73 kDa
• Gene Name: stimulated by retinoic acid 6
• Database Link:
  NP_071764
  Entrez Gene 64220 Human
  UniProt ID Q9BX79
• Background: STRA6 may act as a high-affinity cell-surface receptor for the complex retinol-retinol binding protein (RBP/RBP4). STRA6 acts by removing retinol from RBP/RBP4 and transports it across the plasma membrane, where it can be metabolized. This mechanism does not depend on endocytosis. STRA6 binds to RBP/RBP4 with high affinity. STRA6 increases cellular retinol uptake from the retinol-RBP complex.
• Synonyms: MCOPCB8; MCOPS9; PP14296
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Transmembrane