LENG4 (MBOAT7) Rabbit Polyclonal Antibody

CAT#: TA338651

Rabbit Polyclonal Anti-MBOAT7 Antibody

Product Images

WB Suggested Anti-MBOAT7 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LENG4 antibody: synthetic peptide directed towards the C terminal of human LENG4. Synthetic peptide located within the following region: WWLAQYIYKSAPARSYVLRSAWTMLLSAYWHGLHPGYYLSFLTIPLCLAA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 53 kDa
• Gene Name: membrane bound O-acyltransferase domain containing 7
• Database Link:
  NP_077274
  Entrez Gene 79143 Human
  UniProt ID Q96N66
• Background: MBOAT7 belongs to the membrane-bound acyltransferase family. It is involved in arachidonate recycling, thus regulating free arachidonic acid levels and leukotriene synthesis in neutrophils.
• Synonyms: BB1; hMBOA-7; LENG4; LPIAT; LRC4; MBOA7; OACT7
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Bovine: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Transmembrane