PAQR6 Rabbit Polyclonal Antibody

CAT#: TA338687

Rabbit Polyclonal Anti-PAQR6 Antibody

Product Images

WB Suggested Anti-PAQR6 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: HepG2 cell lysate

• 

  Host: Rabbit; Target Name: PAQR6; Sample Tissue: Jurkat; Antibody Dilution: 1.0 ug/ml PAQR6 is supported by BioGPS gene expression data to be expressed in Jurkat

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PAQR6 antibody: synthetic peptide directed towards the N terminal of human PAQR6. Synthetic peptide located within the following region: PGLSKVLRTGAFAYPFLFDNLPLFYRLGLCWGRGHGCGQEALSTSHGYHL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: progestin and adipoQ receptor family member 6
• Database Link:
  NP_079173
  Entrez Gene 79957 Human
  UniProt ID Q6TCH4
• Background: This protein mediates receptor activity
• Synonyms: PRdelta
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%

Reference Data

• Protein Families: Druggable Genome, Transmembrane