CATSPER2 Rabbit Polyclonal Antibody
CAT#: TA338750
Rabbit Polyclonal Anti-CATSPER2 Antibody
Other products for "CATSPER2"
Specifications
Product Data | |
Applications | IHC, WB |
Recommended Dilution | WB, IHC |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CATSPER2 antibody: synthetic peptide directed towards the N terminal of human CATSPER2. Synthetic peptide located within the following region: HLQGLSQAVPRHTIRELLDPSRQKKLVLGDQHQLVRFSIKPQRIEQISHA |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Protein A purified |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 46 kDa |
Database Link | |
Background | Calcium ions play a primary role in the regulation of sperm motility. This gene belongs to a family of putative cation channels that are specific to spermatozoa and localize to the flagellum. The protein family features a single repeat with six membrane-spanning segments and a predicted calcium-selective pore region. This gene is part of a tandem repeat on chromosome 15q15; the second copy of this gene is thought to be a pseudogene. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jan 2014] |
Synonyms | cation channel; MGC33346; OTTHUMP00000066276; OTTHUMP00000066277; OTTHUMP00000066278; sperm-associated cation channel 2; sperm associated 2; sperm ion channel |
Note | Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Pig: 92%; Horse: 92%; Bovine: 85% |
Reference Data | |
Protein Families | Druggable Genome, Ion Channels: Other, Transmembrane |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.