KCNG4 Rabbit Polyclonal Antibody

CAT#: TA338760

Rabbit Polyclonal Anti-KCNG4 Antibody

Product Images

WB Suggested Anti-KCNG4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: 721_B cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KCNG4 antibody: synthetic peptide directed towards the N terminal of human KCNG4. Synthetic peptide located within the following region: QEELAYWGIEEAHLERCCLRKLLRKLEELEELAKLHREDVLRQQRETRRP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 59 kDa
• Gene Name: potassium voltage-gated channel modifier subfamily G member 4
• Database Link:
  NP_758857
  Entrez Gene 93107 Human
  UniProt ID Q8TDN1
• Background: Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily G. This member functions as a modulatory subunit. The gene has strong expression in brain. Multiple alternatively spliced variants have been found in normal and cancerous tissues. [provided by RefSeq, Jul 2008]
• Synonyms: KV6.3; KV6.4
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Potassium, Transmembrane