NUDT9 Rabbit Polyclonal Antibody

CAT#: TA338789

Rabbit Polyclonal Anti-NUDT9 Antibody

Product Images

WB Suggested Anti-NUDT9 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: Human kidney

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NUDT9 antibody: synthetic peptide directed towards the N terminal of human NUDT9. Synthetic peptide located within the following region: SPKFNEKDGHVERKSKNGLYEIENGRPRNPAGRTGLVGRGLLGRWGPNHA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: nudix hydrolase 9
• Database Link:
  NP_076952
  Entrez Gene 53343 Human
  UniProt ID Q9BW91
• Background: The protein encoded by this gene belongs to the Nudix hydrolase family. Nudix boxes are found in a family of diverse enzymes that catalyze the hydrolysis of nucleoside diphosphate derivatives. This enzyme is an ADP-ribose pyrophosphatase that catalyzes the hydrolysis of ADP-ribose to AMP and ribose-5-P. It requires divalent metal ions and an intact Nudix motif for enzymatic activity. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]
• Synonyms: NUDT10
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 92%; Sheep: 92%; Bovine: 92%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Other
• Protein Pathways: Purine metabolism