PIWIL4 Rabbit Polyclonal Antibody

CAT#: TA338844

Rabbit Polyclonal Anti-PIWIL4 Antibody

Product Images

WB Suggested Anti-PIWIL4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PIWIL4 antibody: synthetic peptide directed towards the N terminal of human PIWIL4. Synthetic peptide located within the following region: SGRARVKARGIARSPSATEVGRIQASPLPRSVDLSNNEASSSNGFLGTSR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 96 kDa
• Gene Name: piwi like RNA-mediated gene silencing 4
• Database Link:
  NP_689644
  Entrez Gene 143689 Human
  UniProt ID Q7Z3Z4
• Background: PIWIL4 belongs to the Argonaute family of proteins, which function in development and maintenance of germline stem cells.PIWIL4 belongs to the Argonaute family of proteins, which function in development and maintenance of germline stem cells (Sasaki et al., 2003 [PubMed 12906857]). [supplied by OMIM]
• Synonyms: HIWI2; MIWI2
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Pathways: Dorso-ventral axis formation