C9orf98 (AK8) Rabbit Polyclonal Antibody

CAT#: TA338875

Rabbit Polyclonal Anti-AK8 Antibody

Product Images

Host: Rabbit; Target Name: AK8; Sample Tissue: Thyroid tumor lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-AK8 antibody is: synthetic peptide directed towards the C-terminal region of Human AK8. Synthetic peptide located within the following region: FDSIMERLTLRRIDPVTGERYHLMYKPPPTMEIQARLLQNPKDAEEQVKL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 30 kDa
• Gene Name: adenylate kinase 8
• Database Link:
  NP_689785
  Entrez Gene 158067 Human
  UniProt ID Q96MA6
• Background: AK8 is a adenylate kinase. It has highest activity toward AMP, and weaker activity toward dAMP, CMP and dCMP.
• Synonyms: AK 8; C9orf98; DDX31
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Bovine: 93%; Rat: 92%; Guinea pig: 92%; Horse: 86%; Mouse: 85%; Rabbit: 77%