p60 CAF1 (CHAF1B) Rabbit Polyclonal Antibody

CAT#: TA338925

Rabbit Polyclonal Anti-CHAF1B Antibody

Product Images

CHAF1B antibody - N-terminal region validated by WB using Mouse brains at 1: 1000.

• 

  WB Suggested Anti-CHAF1B Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Human Liver

• 

  Host: Rabbit; Target Name: CHAF1B; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: CHAF1B; Sample Tissue: HepG2; Antibody Dilution: 1.0 ug/ml.CHAF1B is supported by BioGPS gene expression data to be expressed in HepG2

• 

  Host: Rabbit; Target Name: CHAF1B; Sample Tissue: Jurkat; Antibody Dilution: 1.0 ug/ml.CHAF1B is supported by BioGPS gene expression data to be expressed in Jurkat

• 

  Host: Rabbit; Target Name: CHAF1B; Sample Tissue: 293T; Antibody Dilution: 1.0 ug/ml.CHAF1B is supported by BioGPS gene expression data to be expressed in HEK293T

Show all 6 images

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CHAF1B antibody: synthetic peptide directed towards the N terminal of human CHAF1B. Synthetic peptide located within the following region: KVITCEIAWHNKEPVYSLDFQHGTAGRIHRLASAGVDTNVRIWKVEKGPD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 61 kDa
• Gene Name: chromatin assembly factor 1 subunit B
• Database Link:
  NP_005432
  Entrez Gene 110749 MouseEntrez Gene 8208 Human
  UniProt ID Q13112
• Background: Chromatin assembly factor I (CAF-I) is required for the assembly of histone octamers onto newly-replicated DNA. CAF-I is composed of three protein subunits, p50, p60, and p150. The protein encoded by this gene corresponds to the p60 subunit and is required for chromatin assembly after replication. The encoded protein is differentially phosphorylated in a cell cycle-dependent manner. In addition, it is normally found in the nucleus except during mitosis, when it is released into the cytoplasm. This protein is a member of the WD-repeat HIR1 family and may also be involved in DNA repair. [provided by RefSeq, Jul 2008]
• Synonyms: CAF-1; CAF-IP60; CAF1; CAF1A; CAF1P60; MPHOSPH7; MPP7
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Bovine: 92%; Zebrafish: 92%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors