Sumo 3 Rabbit Polyclonal Antibody

CAT#: TA338929

Rabbit Polyclonal Anti-Sumo3 Antibody

Product Images

Sumo3 Antibody - N-terminal region validated by WB using Mouse Heart lysate at 1 ug/ml.

• 

  Sample: HEK293 cells (10ug, 50ug); Dilution: 1: 1000

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Sumo3 antibody is: synthetic peptide directed towards the N-terminal region of Sumo3. Synthetic peptide located within the following region: PKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 12 kDa
• Database Link:
  NP_008867
  Entrez Gene 20610 Mouse
• Background: Ubiquitin-like protein which can be covalently attached to target lysines either as a monomer or as a lysine-linked polymer. Does not seem to be involved in protein degradation and may function as an antagonist of ubiquitin in the degradation process. Plays a role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Covalent attachment to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by an E3 ligase such as PIAS1-4, RANBP2 or CBX4.
• Synonyms: SMT3A; Smt3B; SMT3H1; SUMO-3
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Dog: 93%

Reference Data

• Protein Families: Druggable Genome