DNase I (DNASE1) Rabbit Polyclonal Antibody

CAT#: TA339005

Rabbit Polyclonal Anti-DNASE1 Antibody

Product Images

WB Suggested Anti-DNASE1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: PANC1 cell lysate.DNASE1 is supported by BioGPS gene expression data to be expressed in PANC1

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DNASE1 antibody: synthetic peptide directed towards the N terminal of human DNASE1. Synthetic peptide located within the following region: GKLLDNLNQDAPDTYHYVVSEPLGRNSYKERYLFVYRPDQVSAVDSYYYD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 29 kDa
• Gene Name: deoxyribonuclease I
• Database Link:
  NP_005214
  Entrez Gene 1773 Human
  UniProt ID P24855
• Background: This gene encodes a member of the DNase family. This protein is stored in the zymogen granules of the nuclear envelope and functions by cleaving DNA in an endonucleolytic manner. At least six autosomal codominant alleles have been characterized, DNASE1*1 through DNASE1*6, and the sequence of DNASE1*2 represented in this record. Mutations in this gene have been associated with systemic lupus erythematosus (SLE), an autoimmune disease. A recombinant form of this protein is used to treat the one of the symptoms of cystic fibrosis by hydrolyzing the extracellular DNA in sputum and reducing its viscosity. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized. [provided by RefSeq, Jul 2008]
• Synonyms: DNL1; DRNI
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 79%; Bovine: 79%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein, Transmembrane