KLF6 Rabbit Polyclonal Antibody

CAT#: TA339058

Rabbit Polyclonal Anti-KLF6 Antibody

Product Images

WB Suggested Anti-KLF6 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KLF6 antibody: synthetic peptide directed towards the middle region of human KLF6. Synthetic peptide located within the following region: SREPSQLWGCVPGELPSPGKVRSGTSGKPGDKGNGDASPDGRRRVHRCHF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 32 kDa
• Gene Name: Kruppel-like factor 6
• Database Link:
  NP_001291
  Entrez Gene 1316 Human
  UniProt ID Q99612
• Background: This gene encodes a member of the Kruppel-like family of transcription factors. The zinc finger protein is a transcriptional activator, and functions as a tumor suppressor. Multiple transcript variants encoding different isoforms have been found for this gene, some of which are implicated in carcinogenesis. [provided by RefSeq, May 2009]
• Synonyms: BCD1; CBA1; COPEB; CPBP; GBF; PAC1; ST12; ZF9
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Dog: 86%; Pig: 86%; Rat: 86%; Horse: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors