VMAT1 (SLC18A1) Rabbit Polyclonal Antibody

CAT#: TA339066

Rabbit Polyclonal Anti-SLC18A1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "SLC18A1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SLC18A1 antibody: synthetic peptide directed towards the N terminal of human SLC18A1. Synthetic peptide located within the following region: MNDTASTIPPPATEAISAHKNNCLQGTGFLEEEITRVGVLFASKAVMQLL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 56 kDa
Gene Name solute carrier family 18 member A1
Background The vesicular monoamine transporter acts to accumulate cytosolic monoamines into vesicles, using the proton gradient maintained across the vesicular membrane. Its proper function is essential to the correct activity of the monoaminergic systems that have been implicated in several human neuropsychiatric disorders. The transporter is a site of action of important drugs, including reserpine and tetrabenazine (Peter et al., 1993 [PubMed 7905859]). See also SLC18A2 (MIM 193001). [supplied by OMIM, Mar 2008]. Transcript Variant: This variant (3) lacks an alternate in-frame exon in the central coding region, compared to variant 1. The resulting isoform (b) has the same N- and C-termini but lacks an internal segment, compared to isoform a. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC006317.2 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025095 [ECO:0000350] ##Evidence-Data-END##
Synonyms CGAT; VAT1; VMAT1
Note Immunogen Sequence Homology: Human: 100%; Pig: 79%; Guinea pig: 79%
Reference Data
Protein Families Transmembrane
Protein Pathways Parkinson's disease

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.