ZNF165 Rabbit Polyclonal Antibody

CAT#: TA339081

Rabbit Polyclonal Anti-ZNF165 Antibody

Product Images

WB Suggested Anti-ZNF165 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: Hela cell lysate

• 

  Immunohistochemistry with Human Placenta lysate tissue at an antibody concentration of 5.0 ug/ml using anti-ZNF165 antibody

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF165 antibody: synthetic peptide directed towards the middle region of human ZNF165. Synthetic peptide located within the following region: ISEASGESQDICKSAGRVKRQWEKESGESQRLSSAQDEGFGKILTHKNTV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 56 kDa
• Gene Name: zinc finger protein 165
• Database Link:
  NP_003438
  Entrez Gene 7718 Human
  UniProt ID P49910
• Background: This gene encodes a member of the Kruppel family of zinc finger proteins. Members of this DNA-binding protein family act as transcriptional regulators. This gene is located within a cluster of zinc finger family members. The encoded protein may play a role in spermatogenesis. [provided by RefSeq, Jul 2008]
• Synonyms: CT53; LD65; ZSCAN7
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 86%; Bovine: 79%

Reference Data

• Protein Families: Stem cell - Pluripotency, Transcription Factors