ZNF239 Rabbit Polyclonal Antibody

CAT#: TA339117

Rabbit Polyclonal Anti-ZNF239 Antibody

Product Images

WB Suggested Anti-ZNF239 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate

• 

  Human Lung

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF239 antibody: synthetic peptide directed towards the middle region of human ZNF239. Synthetic peptide located within the following region: WKSQVVSCSQQRAHTEEKPCDHNNCGKILNTSPDGHPYEKIHTAEKQYEC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 52 kDa
• Gene Name: zinc finger protein 239
• Database Link:
  NP_005665
  Entrez Gene 8187 Human
  UniProt ID Q16600
• Background: MOK2 proteins are DNA- and RNA-binding proteins that are mainly associated with nuclear RNP components, including the nucleoli and extranucleolar structures (Arranz et al., 1997 [PubMed 9121460]). [supplied by OMIM, Mar 2008]. Transcript Variant: This variant (3) differs in the 5' UTR compared to variant 1. Variants 1, 2, 3, and 4 encode the same isoform. ##Evidence-Data-START## Transcript exon combination :: AK292013.1, BX401287.2 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025093 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.
• Synonyms: HOK-2; MOK2
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Transcription Factors