Bcat1 Rabbit Polyclonal Antibody

CAT#: TA339286

Rabbit Polyclonal Anti-Bcat1 Antibody

Product Images

WB Suggested Anti-Bcat1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Mouse Heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Bcat1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ACVVCPVSDILYKGQMLHIPTMENGPKLASRILGKLTDIQYGRVESDWTI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 50 kDa
• Gene Name: branched chain aminotransferase 1, cytosolic
• Database Link:
  NP_001019639
  Entrez Gene 12035 Mouse
  UniProt ID P24288
• Background: Catalyzes the first reaction in the catabolism of the essential branched chain amino acids leucine, isoleucine, and valine.
• Synonyms: BCAT(c); BCT1; DKFZp686E12175; ECA39; MECA39; PNAS-121; PP18
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Sheep: 93%; Bovine: 93%; Rabbit: 93%; Mouse: 86%; Rat: 82%; Guinea pig: 79%