MELK Rabbit Polyclonal Antibody

CAT#: TA339317

Rabbit Polyclonal Anti-MELK Antibody

Product Images

WB Suggested Anti-MELK Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: HT1080 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MELK antibody: synthetic peptide directed towards the middle region of human MELK. Synthetic peptide located within the following region: AVKNEEYFMFPEPKTPVNKNQHKREILTTPNRYTTPSKARNQCLKETPIK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 75 kDa
• Gene Name: maternal embryonic leucine zipper kinase
• Database Link:
  NP_055606
  Entrez Gene 9833 Human
  UniProt ID Q14680
• Background: The protein MELK phosphorylates ZNF622 and may contribute to its redirection to the nucleus. Also it may be involved in the inhibition of spliceosome assembly during mitosis.
• Synonyms: HPK38
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Dog: 93%; Rat: 93%; Rabbit: 87%; Pig: 80%; Guinea pig: 80%; Bovine: 79%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase