EBF2 Rabbit Polyclonal Antibody

CAT#: TA339542

Rabbit Polyclonal Anti-EBF2 Antibody

Product Images

WB Suggested Anti-EBF2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: ACHN cell lysate

• 

  Host: Rabbit; Target Name: EBF2; Sample Tissue: Human Fetal Lung; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EBF2 antibody: synthetic peptide directed towards the middle region of human EBF2. Synthetic peptide located within the following region: GDPERLAKEMLLKRAADLVEALYGTPHNNQDIILKRAADIAEALYSVPRN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 63 kDa
• Gene Name: early B-cell factor 2
• Database Link:
  NP_073150
  Entrez Gene 64641 Human
  UniProt ID Q9HAK2
• Background: The protein encoded by this gene belongs to the COE (Collier/Olf/EBF) family of non-basic, helix-loop-helix transcription factors that have a well conserved DNA binding domain. The COE family proteins play an important role in variety of developmental processes. Studies in mouse suggest that this gene may be involved in the differentiation of osteoblasts. [provided by RefSeq, Oct 2011]
• Synonyms: COE2; E-3; EBF-2; O; OE-3
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%