DBX1 Rabbit Polyclonal Antibody

CAT#: TA339648

Rabbit Polyclonal Anti-DBX1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "DBX1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-DBX1 antibody: synthetic peptide directed towards the middle region of human DBX1. Synthetic peptide located within the following region: GGCREQTLPTKLNPHPDLSDVGQKGPGNEEEEEGPGSPSHRLAYHASSDP
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 41 kDa
Gene Name developing brain homeobox 1
Background DBX1 could have a role in patterning the central nervous system during embryogenesis. DBX1 has a key role in regulating the distinct phenotypic features that distinguish two major classes of ventral interneurons, V0 and V1 neurons. DBX1 regulates the transcription factor profile, neurotransmitter phenotype, intraspinal migratory path and axonal trajectory of V0 neurons, features that differentiate them from an adjacent set of V1 neurons.
Synonyms developing brain homeobox 1
Note Immunogen Sequence Homology: Pig: 100%; Human: 100%; Guinea pig: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 86%; Dog: 85%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.