CCNL2 Rabbit Polyclonal Antibody

CAT#: TA339761

Rabbit Polyclonal Anti-CCNL2 Antibody

Product Images

WB Suggested Anti-CCNL2 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate CCNL2 is supported by BioGPS gene expression data to be expressed in Jurkat

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CCNL2 antibody: synthetic peptide directed towards the N terminal of human CCNL2. Synthetic peptide located within the following region: TGQVLFQRFFYTKSFVKHSMEHVSMACVHLASKIEEAPRRIRDVINVFHR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 24 kDa
• Gene Name: cyclin L2
• Database Link:
  NP_001034666
  Entrez Gene 81669 Human
  UniProt ID Q96S94
• Background: CCNL2 belongs to the cyclin family, Cyclin L subfamily. CCNL2 is a transcriptional regulator which participates in regulating the pre-mRNA splicing process. CCNL2 also modulates the expression of critical apoptotic factor, leading to cell apoptosis.
• Synonyms: ANIA-6B; CCNM; CCNS; HCLA-ISO; HLA-ISO; PCEE; SB138
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data

• Protein Families: Druggable Genome